PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA4G00253
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 322aa    MW: 36803.3 Da    PI: 6.6584
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA4G00253genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.5e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l++ ++++G ++W++ ++   ++R++k+c++rw +yl
        AA4G00253 14 KGPWTPEEDDKLIKHIHKHGHRSWSALPKLADLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding58.51.5e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rgr+++eE++ ++++++ lG++ W+tIa++++ gRt++++k++w+++l
        AA4G00253  67 RGRFSPEEEQTILNLHAVLGNK-WSTIANHLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.31961IPR017930Myb domain
SuperFamilySSF466891.05E-3011108IPR009057Homeodomain-like
SMARTSM007174.7E-151363IPR001005SANT/Myb domain
PfamPF002495.7E-171461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-241568IPR009057Homeodomain-like
CDDcd001673.36E-121661No hitNo description
PROSITE profilePS5129427.29562116IPR017930Myb domain
SMARTSM007179.9E-1766114IPR001005SANT/Myb domain
PfamPF002491.5E-1667112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2869117IPR009057Homeodomain-like
CDDcd001671.95E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MVRSPASDDT SLKKGPWTPE EDDKLIKHIH KHGHRSWSAL PKLADLNRCG KSCRLRWTNY  60
LRPDIKRGRF SPEEEQTILN LHAVLGNKWS TIANHLPGRT DNEIKNFWNT HLKKKLIQMG  120
FDPMTHRPRT DIFSTLSQLM SLTNLRELVD MQQQQVPIED QALFNLQADM AKLQFFQSLL  180
QPLPMNSNIS PNDLHILNLL NSIKENSNNS NLDLNFLNSH LQDLNSLPSL KTLDSNHNQT  240
AVFPQNPDEN HLNQRDNLHS SQIWLQEPVS STQTMLPSHD HYVVDNVGSN LASSSHQEVA  300
AAAWPDHLLD DSLFSNIAYD QS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-29121165108B-MYB
1h8a_C6e-291111624128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_196590.11e-152myb domain protein 92
SwissprotQ8GWP05e-68MYB39_ARATH; Transcription factor MYB39
TrEMBLQ9SBF31e-152Q9SBF3_ARATH; MYB transcription factor
STRINGAT5G10280.11e-152(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10280.11e-139myb domain protein 92